PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 959aa    MW: 105353 Da    PI: 5.7113
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.7e-29589640152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  XP_009137410.1 589 AEKTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 640
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557812.26E-5213284IPR029016GAF domain-like
PROSITE profilePS5151917.723579660IPR003035RWP-RK domain
PfamPF020427.3E-26592640IPR003035RWP-RK domain
SuperFamilySSF542776.54E-23860948No hitNo description
PROSITE profilePS5174527.911863945IPR000270PB1 domain
PfamPF005644.7E-19863944IPR000270PB1 domain
SMARTSM006661.4E-26863945IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.8E-27863945No hitNo description
CDDcd064071.00E-33864944No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MCDPADDDTA RNGVTPPASS RRSREILMDV DDLDLDGSWP LDQIPYLSSA SRMISPIFVS  60
SSSEQPCSPL WAFSDGGVNG NHGGYDGEKI TSASGVSSFR LADYPLFLPY ASSSSVAETT  120
TEKHSSFQFP SPLMSLVPSE NADNYCVIKE RMTQALRYFK ESTEQHVLAQ VWAPVRKNGR  180
DLLTTLGQPF VLNPNGNGLN QYRMISLTYM FSVDSDCDVE LGLPGRVFRQ KLPEWTPNVQ  240
YYSSKEFSRL DHALHYNVRG TLALPVFNPS DESCIGVVEL IMTSEKIHYA PEVDKVCKAL  300
EAVNLKSSEI LDHQTTQICN ESRQNALAEI LEVLTVVCET HNLPLAQTWV PCQHGSVLAN  360
GGGLKKNCTS FDGSCRGQVC MSTTDMACYV VDAHVWGFRD ACLEHHLQKG QGVAGRAFLN  420
GGSCFCRDIT KFCKTQYPLV HYALMFKLTS CFAISLQSSY TGDDSYILEF FLPSTITDDQ  480
EQDSLLGSLL VTMKEHFQSL RVASGVDFGE DDDKLSFEII QALPDKKIQS KIESIRVPFS  540
GFKSNATERL LIPQPAAQSS NPANEKVNVA SANGVAKEKK KTEKKRGKAE KTISLDVLQQ  600
YFTGSLKDAA KSLGVCPTTM KRICRQHGIS RWPSRKIKKV NRSITKLKRV IESVQGTDGG  660
LDLTSMAVSS IPWTNGQTGA QPLNSPSGSK PPELPNTNHS PNHWSSDHSP QEPNGSPELP  720
SNGHKRSRTG DESAGTPTSH GSCDGNQLDE TKVPNQDPLF TVGASPGLCF PPYSRDHDVS  780
AASFAIPNRL LGNIDHSRGM PIEDAGSSKD LRNLCSSTPF DDKFPESNWM NNDNNSNNNM  840
YAPAKEEAVA NTTREPSGSE MRTVTIKASY KEDIIRFKIS SGSGIMELKD EVAKRLKLDA  900
GTFDIKYLDD DNEWVLIACD VDLQECLDIP RSSRTNIVRL LVHDVTTNLG SSCESTGEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2284520.0AK228452.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL15-03-P13.
GenBankBT0057760.0BT005776.1 Arabidopsis thaliana clone RAFL15-03-P13 (R20174) unknown protein (At4g24020) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137410.10.0PREDICTED: protein NLP7-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM4DRV80.0M4DRV8_BRARP; Uncharacterized protein
STRINGBra019251.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7